PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00020421001
Common NameGSBRNA2T00020421001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 410aa    MW: 45786.8 Da    PI: 6.6164
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00020421001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.8e-32227281155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fveav++LGGse+AtPk++l+l+k +gLt++hvkSHLQkYR+
  GSBRNA2T00020421001 227 KQRMRWTPELHEAFVEAVNNLGGSERATPKAVLKLLKNPGLTIYHVKSHLQKYRT 281
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.249224284IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-29225283IPR009057Homeodomain-like
SuperFamilySSF466892.15E-16225281IPR009057Homeodomain-like
TIGRFAMsTIGR015579.2E-23227281IPR006447Myb domain, plants
PfamPF002495.0E-10229280IPR001005SANT/Myb domain
PfamPF143792.5E-20315361IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 410 aa     Download sequence    Send to blast
MTLANDFRYS TAMSSSFSPL HATVEDRYRK FPNSYWGSSG QELMNNPVPC HVLNSGGYIL  60
SSSSGYCNVS AVSAHGRTSQ THPPVSTMPS DRLAMQSSLI NHHHPQEFSD PLDEFFDFSD  120
HASAPIPQED GSGVKVVSSV ELHEKSEWQT WADQLMSVDN GSEPNWSELL GDPSPHNPNS  180
QVQSCHDLQQ APTPPRQEII ANQQHQVVSS EEQLGGRNSS ASGATSKQRM RWTPELHEAF  240
VEAVNNLGGS ERATPKAVLK LLKNPGLTIY HVKSHLQKYR TARYKPDTSE ATGETQEKKI  300
TSIEDIKSLD MKTSVEITQA LRLQMEVQKR LHEQLEIQRS LQLQIEKQGR QLQMMFEKQQ  360
KLQENKSSSS ELSPKQCNGT SAEVKFGLET QTRNQTESAL ASRKRTRED*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00020421001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3527940.0AK352794.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-05-N05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009111912.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_009111911.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN50.0PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078J3F80.0A0A078J3F8_BRANA; BnaA09g03540D protein
STRINGBra036123.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.20.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]